PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7BL_A46F1A830.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 305aa    MW: 33664.1 Da    PI: 9.6474
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7BL_A46F1A830.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY92.14.3e-29100156259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                             Dg+nWrKYGqK+vk+s+++rsYYrCt ++C +kkkve++  d++v+ei+Y+g+H he
  Traes_7BL_A46F1A830.2 100 GDGFNWRKYGQKQVKSSDNSRSYYRCTNSSCLAKKKVEHCP-DGRVTEIIYRGTHSHE 156
                            6****************************************.***************8 PP

2WRKY35.22.4e-11268288222
                            --SS-EEEEEEE--TT-SS-E CS
                   WRKY   2 dDgynWrKYGqKevkgsefpr 22 
                            +Dgy+WrKYGqK vkg+++pr
  Traes_7BL_A46F1A830.2 268 SDGYRWRKYGQKIVKGNPNPR 288
                            8*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.0E-2688158IPR003657WRKY domain
SuperFamilySSF1182902.09E-2393158IPR003657WRKY domain
PROSITE profilePS5081121.21894158IPR003657WRKY domain
SMARTSM007749.4E-3099157IPR003657WRKY domain
PfamPF031063.6E-22101155IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.9E-9260289IPR003657WRKY domain
PROSITE profilePS5081113.196262288IPR003657WRKY domain
SuperFamilySSF1182901.29E-8262289IPR003657WRKY domain
SMARTSM007746.4E-4267302IPR003657WRKY domain
PfamPF031061.1E-7269290IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MLAVPCFIAP PGFAGQFAMS HQAALASVTA QAHIQLQSPA SAAYSEGLPS PFPHPITPKA  60
IRPLQQAPSV TQGSIGRPIA ERPSSSESKL QHHAAVNIVG DGFNWRKYGQ KQVKSSDNSR  120
SYYRCTNSSC LAKKKVEHCP DGRVTEIIYR GTHSHEPPQK TRFVKERSPH IYVPPIGDGT  180
LQLVNTEIVE SRTPTCKLNQ SAAIENSEQQ LFCSSDCEGD VGNKSEDEHR SAESQPKRRI  240
VEATTSNLTP VLRTVREQKI IVQAGKMSDG YRWRKYGQKI VKGNPNPRCV LLLLTHGYFS  300
ESIKH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-1284158277Probable WRKY transcription factor 4
2lex_A2e-1284158277Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8273960.0KR827396.1 Triticum aestivum WRKY45 transcriptional factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571606.11e-177PREDICTED: probable WRKY transcription factor 32
TrEMBLW5HPL60.0W5HPL6_WHEAT; Uncharacterized protein
STRINGBRADI3G19640.11e-176(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58203455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.12e-48WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]